Lineage for d2c9tf_ (2c9t F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2085014Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2085015Protein automated matches [193506] (6 species)
    not a true protein
  7. 2085046Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)
  8. 2085107Domain d2c9tf_: 2c9t F: [230589]
    automated match to d2qc1b_

Details for d2c9tf_

PDB Entry: 2c9t (more details), 2.25 Å

PDB Description: crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with alpha-conotoxin imi
PDB Compounds: (F:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2c9tf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9tf_ b.96.1.0 (F:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2c9tf_:

Click to download the PDB-style file with coordinates for d2c9tf_.
(The format of our PDB-style files is described here.)

Timeline for d2c9tf_: