Lineage for d1niaa1 (1nia A:8-166)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 661004Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 661005Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries)
  8. 661030Domain d1niaa1: 1nia A:8-166 [23058]

Details for d1niaa1

PDB Entry: 1nia (more details), 2.5 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
PDB Compounds: (A:) nitrite reductase

SCOP Domain Sequences for d1niaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1niaa1 b.6.1.3 (A:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOP Domain Coordinates for d1niaa1:

Click to download the PDB-style file with coordinates for d1niaa1.
(The format of our PDB-style files is described here.)

Timeline for d1niaa1: