Lineage for d2bzrd1 (2bzr D:21-277)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835938Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1836100Protein automated matches [226926] (3 species)
    not a true protein
  7. 1836171Species Mycobacterium tuberculosis [TaxId:83332] [230567] (1 PDB entry)
  8. 1836177Domain d2bzrd1: 2bzr D:21-277 [230574]
    automated match to d2a7sa1

Details for d2bzrd1

PDB Entry: 2bzr (more details), 2.2 Å

PDB Description: crystal structure of accd5 (rv3280), an acyl-coa carboxylase beta-subunit from mycobacterium tuberculosis
PDB Compounds: (D:) propionyl-coa carboxylase beta chain 5

SCOPe Domain Sequences for d2bzrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzrd1 c.14.1.4 (D:21-277) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldalak
hrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqelai
ktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvyspa
ltdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdafd
yvrellsylppnnstda

SCOPe Domain Coordinates for d2bzrd1:

Click to download the PDB-style file with coordinates for d2bzrd1.
(The format of our PDB-style files is described here.)

Timeline for d2bzrd1: