Lineage for d2bzrc2 (2bzr C:278-548)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099959Protein automated matches [226926] (3 species)
    not a true protein
  7. 2100030Species Mycobacterium tuberculosis [TaxId:83332] [230567] (1 PDB entry)
  8. 2100035Domain d2bzrc2: 2bzr C:278-548 [230573]
    automated match to d2a7sa2

Details for d2bzrc2

PDB Entry: 2bzr (more details), 2.2 Å

PDB Description: crystal structure of accd5 (rv3280), an acyl-coa carboxylase beta-subunit from mycobacterium tuberculosis
PDB Compounds: (C:) propionyl-coa carboxylase beta chain 5

SCOPe Domain Sequences for d2bzrc2:

Sequence, based on SEQRES records: (download)

>d2bzrc2 c.14.1.4 (C:278-548) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pryqaaaptgpieenltdedleldtlipdspnqpydmhevitrllddefleiqagyaqni
vvgfgridgrpvgivanqpthfagcldinasekaarfvrtcdcfnipivmlvdvpgflpg
tdqeyngiirrgakllyaygeatvpkitvitrkayggaycvmgskdmgcdvnlawptaqi
avmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtlvnpyvaaergyvgavipp
shtrgyigtalrllerkiaqlppkkhgnvpl

Sequence, based on observed residues (ATOM records): (download)

>d2bzrc2 c.14.1.4 (C:278-548) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pryqaaaptgpieenltdedleldtlipdspnqpydmhevitrllddefleiqagyaqni
vvgfgridgrpvgivanqpthfagcldinasekaarfvrtcdcfnipivmlvdvpgflpg
tdqeyngiirrgakllyaygeatvpkitvitrkayggaycvmgskdmgcdvnlawptaqi
avmgasgavgfvyrrlrlqqeyedtlvnpyvaaergyvgavippshtrgyigtalrller
kkkhgnvpl

SCOPe Domain Coordinates for d2bzrc2:

Click to download the PDB-style file with coordinates for d2bzrc2.
(The format of our PDB-style files is described here.)

Timeline for d2bzrc2: