SCOP 1.57: Domain d2nrd_2: 2nrd 167-340

Lineage for d2nrd_2 (2nrd 167-340)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)

6. Protein Nitrite reductase, NIR [49551] (3 species)

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (7 PDB entries)

8. Domain d2nrd_2: 2nrd 167-340 [23057]

Details for d2nrd_2

PDB Entry: 2nrd, 2.1 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted

SCOP Domain Sequences for d2nrd_2:

Sequence; same for both SEQRES and ATOM records:

>d2nrd_2 b.6.1.3 (167-340) Nitrite reductase, NIR {Achromobacter cycloclastes}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

Timeline for d2nrd_2:

• d2nrd_2 first appeared (with stable ids) in SCOP 1.55
  
• d2nrd_2 appears in SCOP 1.59
  
• d2nrd_2 appears in the current release, SCOPe 2.08, called d2nrda2