Lineage for d2bznc_ (2bzn C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338632Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 1338674Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 1338675Protein automated matches [227084] (6 species)
    not a true protein
  7. 1338698Species Homo sapiens [TaxId:9606] [230557] (1 PDB entry)
  8. 1338701Domain d2bznc_: 2bzn C: [230561]
    automated match to d4mjma_

Details for d2bznc_

PDB Entry: 2bzn (more details), 2.15 Å

PDB Description: crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp
PDB Compounds: (C:) GMP reductase 2

SCOPe Domain Sequences for d2bznc_:

Sequence, based on SEQRES records: (download)

>d2bznc_ c.1.5.0 (C:) automated matches {Homo sapiens [TaxId: 9606]}
sldfkdvllrpkrstlksrsevdltrsfsfrnskqtysgvpiiaanmdtvgtfemakvlc
kfslftavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileaipqvkyicl
dvangysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgigpgsvctt
rkktgvgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvmlggmlagh
sesggelierdgkkyklfygmssemamkkyaggvaeyrasegktvevpfkgdvehtirdi
lggirstctyvgaaklkelsrrttfirv

Sequence, based on observed residues (ATOM records): (download)

>d2bznc_ c.1.5.0 (C:) automated matches {Homo sapiens [TaxId: 9606]}
sldfkdvllrpkrstlkevdltrsfsfrnskqtysgvpiiaanmdtvgtfemakvlckfs
lftavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileaipqvkyicldva
ngysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgigpgsvcttrkk
tgvgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvmlggmlaghses
ggelierdgkkyklfygmssemamkkyasegktvevpfkgdvehtirdilggirstctyv
gaaklkelsrrttfirv

SCOPe Domain Coordinates for d2bznc_:

Click to download the PDB-style file with coordinates for d2bznc_.
(The format of our PDB-style files is described here.)

Timeline for d2bznc_:

  • d2bznc_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-11
  • d2bznc_ appears in SCOPe 2.04
  • d2bznc_ appears in the current release, SCOPe 2.07, called d2bznc1