Lineage for d2bzna1 (2bzn A:10-336)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080793Species Human (Homo sapiens) [TaxId:9606] [230557] (5 PDB entries)
  8. 2080803Domain d2bzna1: 2bzn A:10-336 [230558]
    Other proteins in same PDB: d2bzna2, d2bznb2, d2bznc2, d2bznd2, d2bzne2, d2bznf2, d2bzng2, d2bznh2
    automated match to d4mjma_
    complexed with imp

Details for d2bzna1

PDB Entry: 2bzn (more details), 2.15 Å

PDB Description: crystal structure of human guanosine monophosphate reductase 2 gmpr2 in complex with imp
PDB Compounds: (A:) GMP reductase 2

SCOPe Domain Sequences for d2bzna1:

Sequence, based on SEQRES records: (download)

>d2bzna1 c.1.5.0 (A:10-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldfkdvllrpkrstlksrsevdltrsfsfrnskqtysgvpiiaanmdtvgtfemakvlck
fslftavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileaipqvkyicld
vangysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgigpgsvcttr
kktgvgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvmlggmlaghs
esggelierdgkkyklfygmssemamkkyaggvaeyrasegktvevpfkgdvehtirdil
ggirstctyvgaaklkelsrrttfirv

Sequence, based on observed residues (ATOM records): (download)

>d2bzna1 c.1.5.0 (A:10-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldfkdvllrpkrstlksrsevdltrsfsfrnskqtysgvpiiaanmdtvgtfemakvlck
fslftavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileaipqvkyicld
vangysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgigpgsvcttr
kktgvgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvmlggmlaghs
esggelierdgkkyklfygmssemamkkyasegktvevpfkgdvehtirdilggirstct
yvgaaklkelsrrttfirv

SCOPe Domain Coordinates for d2bzna1:

Click to download the PDB-style file with coordinates for d2bzna1.
(The format of our PDB-style files is described here.)

Timeline for d2bzna1: