SCOPe 2.06: Domain d2bv5a_: 2bv5 A:

Lineage for d2bv5a_ (2bv5 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (117 PDB entries)

8. Domain d2bv5a_: 2bv5 A: [230551]
   automated match to d2a8ba_
   complexed with gol, so4

Details for d2bv5a_

PDB Entry: 2bv5, 1.8 Å

PDB Description: crystal structure of the human protein tyrosine phosphatase ptpn5 at 1.8a resolution

PDB Compounds: (A:) tyrosine-protein phosphatase, non-receptor type 5

SCOPe Domain Sequences for d2bv5a_:

Sequence; same for both SEQRES and ATOM records:

>d2bv5a_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spsrvlqaeelhekaldpfllqaeffeipmnfvdpkeydipglvrknryktilpnphsrv
cltspdpddplssyinanyirgyggeekvyiatqgpivstvadfwrmvwqehtpiivmit
nieemnekcteywpeeqvaydgveitvqkvihtedyrlrlislksgteerglkhywftsw
pdqktpdrappllhlvreveeaaqqegphcapiivhcsagigrtgcfiatsiccqqlrqe
gvvdilkttcqlrqdrggmiqtceqyqfvhhvmslyekqlsh

Timeline for d2bv5a_:

• d2bv5a_ first appeared in SCOPe 2.03
  
• d2bv5a_ appears in SCOPe 2.05
  
• d2bv5a_ appears in SCOPe 2.07
  
• d2bv5a_ appears in the current release, SCOPe 2.08