Class b: All beta proteins [48724] (141 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins) |
Protein Nitrite reductase, NIR [49551] (4 species) consists of two domains of this fold |
Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries) |
Domain d1nid_2: 1nid 167-340 [23055] complexed with cu, no2 |
PDB Entry: 1nid (more details), 2.2 Å
SCOP Domain Sequences for d1nid_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nid_2 b.6.1.3 (167-340) Nitrite reductase, NIR {Achromobacter cycloclastes} gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
Timeline for d1nid_2: