Lineage for d2bt2e1 (2bt2 E:53-187)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332890Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2332891Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2332952Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2332953Protein automated matches [190464] (3 species)
    not a true protein
  7. 2332962Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2332972Domain d2bt2e1: 2bt2 E:53-187 [230548]
    Other proteins in same PDB: d2bt2a2, d2bt2b2, d2bt2c2, d2bt2d2, d2bt2e2
    automated match to d2af0a_

Details for d2bt2e1

PDB Entry: 2bt2 (more details), 1.9 Å

PDB Description: structure of the regulator of g-protein signaling 16
PDB Compounds: (E:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d2bt2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bt2e1 a.91.1.0 (E:53-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkirsatklas
rahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmekdsyprfl
kspayrdlaaqasaa

SCOPe Domain Coordinates for d2bt2e1:

Click to download the PDB-style file with coordinates for d2bt2e1.
(The format of our PDB-style files is described here.)

Timeline for d2bt2e1: