SCOPe 2.05: Domain d2bt2b_: 2bt2 B:

Lineage for d2bt2b_ (2bt2 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)

8. Domain d2bt2b_: 2bt2 B: [230545]
   automated match to d2af0a_

Details for d2bt2b_

PDB Entry: 2bt2, 1.9 Å

PDB Description: structure of the regulator of g-protein signaling 16

PDB Compounds: (B:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d2bt2b_:

Sequence; same for both SEQRES and ATOM records:

>d2bt2b_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkir
satklasrahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmek
dsyprflkspayrdlaaqasaa

Timeline for d2bt2b_:

• d2bt2b_ first appeared in SCOPe 2.03
  
• d2bt2b_ appears in SCOPe 2.04
  
• d2bt2b_ is called d2bt2b1 in SCOPe 2.06
  
• d2bt2b_ appears in the current release, SCOPe 2.08, called d2bt2b1