Lineage for d2bt2b_ (2bt2 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275178Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1275179Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1275237Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 1275238Protein automated matches [190464] (2 species)
    not a true protein
  7. 1275242Species Human (Homo sapiens) [TaxId:9606] [187381] (10 PDB entries)
  8. 1275247Domain d2bt2b_: 2bt2 B: [230545]
    automated match to d2af0a_

Details for d2bt2b_

PDB Entry: 2bt2 (more details), 1.9 Å

PDB Description: structure of the regulator of g-protein signaling 16
PDB Compounds: (B:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d2bt2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bt2b_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkir
satklasrahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmek
dsyprflkspayrdlaaqasaa

SCOPe Domain Coordinates for d2bt2b_:

Click to download the PDB-style file with coordinates for d2bt2b_.
(The format of our PDB-style files is described here.)

Timeline for d2bt2b_: