| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
| Protein automated matches [190464] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries) |
| Domain d2bt2b1: 2bt2 B:53-187 [230545] Other proteins in same PDB: d2bt2a2, d2bt2b2, d2bt2c2, d2bt2d2, d2bt2e2 automated match to d2af0a_ |
PDB Entry: 2bt2 (more details), 1.9 Å
SCOPe Domain Sequences for d2bt2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bt2b1 a.91.1.0 (B:53-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkirsatklas
rahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmekdsyprfl
kspayrdlaaqasaa
Timeline for d2bt2b1: