Class a: All alpha proteins [46456] (284 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
Protein automated matches [190464] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187381] (10 PDB entries) |
Domain d2bt2a_: 2bt2 A: [230544] automated match to d2af0a_ |
PDB Entry: 2bt2 (more details), 1.9 Å
SCOPe Domain Sequences for d2bt2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bt2a_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nlyfqsmrnfsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkir satklasrahqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmek dsyprflkspayrdlaaqasaas
Timeline for d2bt2a_:
View in 3D Domains from other chains: (mouse over for more information) d2bt2b_, d2bt2c_, d2bt2d_, d2bt2e_ |