SCOPe 2.07: Domain d1nida1: 1nid A:8-166

Lineage for d1nida1 (1nid A:8-166)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (60 PDB entries)

8. Domain d1nida1: 1nid A:8-166 [23054]
   complexed with cu, no2

Details for d1nida1

PDB Entry: 1nid, 2.2 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1nida1:

Sequence; same for both SEQRES and ATOM records:

>d1nida1 b.6.1.3 (A:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d1nida1:

• d1nida1 first appeared (with stable ids) in SCOP 1.55, called d1nid_1
  
• d1nida1 appears in SCOPe 2.06
  
• d1nida1 appears in the current release, SCOPe 2.08