SCOP 1.65: Domain d1nid_1: 1nid 8-166

Lineage for d1nid_1 (1nid 8-166)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)

6. Protein Nitrite reductase, NIR [49551] (4 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (7 PDB entries)

8. Domain d1nid_1: 1nid 8-166 [23054]

Details for d1nid_1

PDB Entry: 1nid, 2.2 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted

SCOP Domain Sequences for d1nid_1:

Sequence; same for both SEQRES and ATOM records:

>d1nid_1 b.6.1.3 (8-166) Nitrite reductase, NIR {Achromobacter cycloclastes}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d1nid_1:

• d1nid_1 first appeared (with stable ids) in SCOP 1.55
  
• d1nid_1 appears in SCOP 1.63
  
• d1nid_1 appears in SCOP 1.67
  
• d1nid_1 appears in the current release, SCOPe 2.08, called d1nida1