![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
![]() | Family b.3.6.0: automated matches [227249] (1 protein) not a true family |
![]() | Protein automated matches [227026] (4 species) not a true protein |
![]() | Species Rhodococcus opacus [TaxId:37919] [225810] (11 PDB entries) |
![]() | Domain d2boyc_: 2boy C: [230538] automated match to d3hgia_ complexed with bho, fe, lpp, mg |
PDB Entry: 2boy (more details), 1.9 Å
SCOPe Domain Sequences for d2boyc_:
Sequence, based on SEQRES records: (download)
>d2boyc_ b.3.6.0 (C:) automated matches {Rhodococcus opacus [TaxId: 37919]} stdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaies vaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladvl ldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgallaa agwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieaqsgp hfetsykftlgkv
>d2boyc_ b.3.6.0 (C:) automated matches {Rhodococcus opacus [TaxId: 37919]} stdrtgnivgkmiaainavikdekvsyseykastgwlisvgeknewplfldvffehaies vaaesnrgsqssiqgpyfipgapelsipytmpmrddesgdtlifrgevvdqegapladvl ldmwqadaageysfinptlpdylfrgkirtdengrftlrtivpapyeipkngptgallaa agwhawrpahlhwiiakegyeslttqlyfengqwtgsdvanavkpelllsldkieagphf etsykftlgkv
Timeline for d2boyc_: