Lineage for d2bivc2 (2biv C:153-243)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. Protein automated matches [191144] (3 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)
  8. Domain d2bivc2: 2biv C:153-243 [230534]
    automated match to d1oz3a3
    complexed with iod, na

Details for d2bivc2

PDB Entry: 2biv (more details), 1.7000000000000002 Å

PDB Description: crystal structure of the wild-type mbt domains of human scml2
PDB Compounds: (C:) sex comb on midleg-like protein 2

SCOPe Domain Sequences for d2bivc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bivc2 b.34.9.0 (C:153-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkgdevhitfdgwsga
fdywckydsrdifpagwcrltgdvlqppgts

SCOPe Domain Coordinates for d2bivc2 are not available.

Timeline for d2bivc2:

Domains from same chain:
(mouse over for more information)
d2bivc1
Domains from other chains:
(mouse over for more information)
d2biva1, d2biva2, d2bivb1, d2bivb2