| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
| Protein automated matches [191144] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries) |
| Domain d2bivc1: 2biv C:32-133 [230533] automated match to d1oz3a1 complexed with iod, na |
PDB Entry: 2biv (more details), 1.7 Å
SCOPe Domain Sequences for d2bivc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bivc1 b.34.9.0 (C:32-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitga
rlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplg
Timeline for d2bivc1:
View in 3DDomains from other chains: (mouse over for more information) d2biva1, d2biva2, d2bivb1, d2bivb2 |