SCOPe 2.03: Domain d2bivc1: 2biv C:32-133

Lineage for d2bivc1 (2biv C:32-133)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189286] (4 PDB entries)

8. Domain d2bivc1: 2biv C:32-133 [230533]
   Other proteins in same PDB: d2biva1, d2biva2, d2bivb1, d2bivb2
   automated match to d1oz3a1
   complexed with iod, na

Details for d2bivc1

PDB Entry: 2biv, 1.7 Å

PDB Description: crystal structure of the wild-type mbt domains of human scml2

PDB Compounds: (C:) sex comb on midleg-like protein 2

SCOPe Domain Sequences for d2bivc1:

Sequence; same for both SEQRES and ATOM records:

>d2bivc1 b.34.9.0 (C:32-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitga
rlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplg

Timeline for d2bivc1:

• d2bivc1 is new in SCOPe 2.03-stable
  
• d2bivc1 appears in SCOPe 2.04
  
• d2bivc1 appears in the current release, SCOPe 2.08