Lineage for d2ayta1 (2ayt A:1-121)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879076Species Aquifex aeolicus [TaxId:63363] [225093] (1 PDB entry)
  8. 2879077Domain d2ayta1: 2ayt A:1-121 [230514]
    Other proteins in same PDB: d2ayta3, d2aytb3
    automated match to d2aytb1
    complexed with gol, so4

Details for d2ayta1

PDB Entry: 2ayt (more details), 2.4 Å

PDB Description: The crystal structure of a protein disulfide oxidoreductase from aquifex aeolicus
PDB Compounds: (A:) glutaredoxin-like protein

SCOPe Domain Sequences for d2ayta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayta1 c.47.1.0 (A:1-121) automated matches {Aquifex aeolicus [TaxId: 63363]}
mllnldvrmqlkelaqkefkepvsiklfsqaigcescqtaeellketvevigeavgqdki
kldiyspfthkeetekygvdrvptiviegdkdygiryiglpaglefttlingifhvsqrk
p

SCOPe Domain Coordinates for d2ayta1:

Click to download the PDB-style file with coordinates for d2ayta1.
(The format of our PDB-style files is described here.)

Timeline for d2ayta1: