Lineage for d2ajqa2 (2ajq A:211-704)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016741Protein T7 phage DNA polymerase [56678] (1 species)
  7. 3016742Species Bacteriophage T7 [TaxId:10760] [56679] (17 PDB entries)
    Uniprot P00581
  8. 3016754Domain d2ajqa2: 2ajq A:211-704 [230511]
    Other proteins in same PDB: d2ajqa1, d2ajqb_, d2ajqf1, d2ajqi_
    automated match to d1x9ma2
    protein/DNA complex

Details for d2ajqa2

PDB Entry: 2ajq (more details), 2.6 Å

PDB Description: structure of replicative dna polymerase provides insigts into the mechanisms for processivity, frameshifting and editing
PDB Compounds: (A:) T7 DNA polymerase

SCOPe Domain Sequences for d2ajqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajqa2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve
hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl
miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq
craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq
iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq
qtlvessqwvageqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikte
emlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrcll
dtegkmgpnwaich

SCOPe Domain Coordinates for d2ajqa2:

Click to download the PDB-style file with coordinates for d2ajqa2.
(The format of our PDB-style files is described here.)

Timeline for d2ajqa2: