![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species) |
![]() | Species Bacteriophage T7 [TaxId:10760] [53124] (17 PDB entries) Uniprot P00581 |
![]() | Domain d2ajqa1: 2ajq A:1-210 [230510] Other proteins in same PDB: d2ajqa2, d2ajqb_, d2ajqf2, d2ajqi_ automated match to d1x9ma1 protein/DNA complex |
PDB Entry: 2ajq (more details), 2.6 Å
SCOPe Domain Sequences for d2ajqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ajqa1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]} mivsaiaanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgkrf gshaleawgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtka llekllsdkhyfppeidftdvgyttfwses
Timeline for d2ajqa1:
![]() Domains from other chains: (mouse over for more information) d2ajqb_, d2ajqf1, d2ajqf2, d2ajqi_ |