SCOPe 2.03: Domain d2aefb1: 2aef B:116-244

Lineage for d2aefb1 (2aef B:116-244)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
   automatically mapped to Pfam PF02254

6. Protein Potassium channel-related protein MthK [75122] (1 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (5 PDB entries)

8. Domain d2aefb1: 2aef B:116-244 [230502]
   Other proteins in same PDB: d2aefa2, d2aefb2
   automated match to d1lnqa3

Details for d2aefb1

PDB Entry: 2aef, 1.7 Å

PDB Description: Crystal Structures of the MthK RCK Domain in Ca2+ bound form

PDB Compounds: (B:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d2aefb1:

Sequence; same for both SEQRES and ATOM records:

>d2aefb1 c.2.1.9 (B:116-244) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsid

Timeline for d2aefb1:

• d2aefb1 is new in SCOPe 2.03-stable
  
• d2aefb1 appears in SCOPe 2.04
  
• d2aefb1 appears in the current release, SCOPe 2.08