Lineage for d2ab5a2 (2ab5 A:390-517)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966038Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2966049Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2966172Family d.95.2.0: automated matches [230493] (1 protein)
    not a true family
  6. 2966173Protein automated matches [230494] (1 species)
    not a true protein
  7. 2966174Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [230495] (1 PDB entry)
  8. 2966176Domain d2ab5a2: 2ab5 A:390-517 [230499]
    automated match to d1p8kz2
    complexed with so4

Details for d2ab5a2

PDB Entry: 2ab5 (more details), 2.2 Å

PDB Description: bi3 laglidadg maturase
PDB Compounds: (A:) mRNA maturase

SCOPe Domain Sequences for d2ab5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ab5a2 d.95.2.0 (A:390-517) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nttedilnknyfsswligffeakscfsiykpmnkkmktasfevsmnnnmevmlaiksylk
innniymnefnnskmttksindiknvvmfinnnpikllgykklqyllflkdlrtitkynn
yfkipsky

SCOPe Domain Coordinates for d2ab5a2:

Click to download the PDB-style file with coordinates for d2ab5a2.
(The format of our PDB-style files is described here.)

Timeline for d2ab5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ab5a1