![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
![]() | Superfamily d.95.2: Homing endonucleases [55608] (3 families) ![]() |
![]() | Family d.95.2.0: automated matches [230493] (1 protein) not a true family |
![]() | Protein automated matches [230494] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [230495] (1 PDB entry) |
![]() | Domain d2ab5a2: 2ab5 A:390-517 [230499] automated match to d1p8kz2 complexed with so4 |
PDB Entry: 2ab5 (more details), 2.2 Å
SCOPe Domain Sequences for d2ab5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ab5a2 d.95.2.0 (A:390-517) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nttedilnknyfsswligffeakscfsiykpmnkkmktasfevsmnnnmevmlaiksylk innniymnefnnskmttksindiknvvmfinnnpikllgykklqyllflkdlrtitkynn yfkipsky
Timeline for d2ab5a2: