SCOPe 2.08: Domain d2ab5b2: 2ab5 B:390-517

Lineage for d2ab5b2 (2ab5 B:390-517)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.0: automated matches [230493] (1 protein)
   not a true family

6. Protein automated matches [230494] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [230495] (1 PDB entry)

8. Domain d2ab5b2: 2ab5 B:390-517 [230497]
   automated match to d1p8kz2
   complexed with so4

Details for d2ab5b2

PDB Entry: 2ab5, 2.2 Å

PDB Description: bi3 laglidadg maturase

PDB Compounds: (B:) mRNA maturase

SCOPe Domain Sequences for d2ab5b2:

Sequence, based on SEQRES records:

>d2ab5b2 d.95.2.0 (B:390-517) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nttedilnknyfsswligffeakscfsiykpmnkkmktasfevsmnnnmevmlaiksylk
innniymnefnnskmttksindiknvvmfinnnpikllgykklqyllflkdlrtitkynn
yfkipsky

Sequence, based on observed residues (ATOM records):

>d2ab5b2 d.95.2.0 (B:390-517) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nttedilnknyfsswligffeakscfsiykmktasfevsmnnnmevmlaiksylkinnni
ymnefnnskmttksindiknvvmfinnnpikllgykklqyllflkdlrtitkynnyfkip
sky

Timeline for d2ab5b2:

• d2ab5b2 first appeared in SCOPe 2.03
  
• d2ab5b2 appears in SCOPe 2.07