![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Chloroflexus aurantiacus [TaxId:1108] [230491] (1 PDB entry) |
![]() | Domain d2aana_: 2aan A: [230492] automated match to d1cuoa_ complexed with cu, so4 |
PDB Entry: 2aan (more details), 1.85 Å
SCOPe Domain Sequences for d2aana_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aana_ b.6.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 1108]} gpvtieigskgeelafdkteltvsagqtvtirfknnsavqqhnwilvkggeaeaaniana glsagpaanylpadksniiaesplangnetvevtftapaagtylyictvpghyplmqgkl vvn
Timeline for d2aana_: