Lineage for d1nif_2 (1nif 167-340)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins) Protein Nitrite reductase, NIR [49551] (3 species) 
Species Achromobacter cycloclastes [TaxId:223] [49552] (7 PDB entries) 
Domain d1nif_2: 1nif 167-340 [23049]
Details for d1nif_2
PDB Entry: 1nif (more details), 1.6 Å
PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
SCOP Domain Sequences for d1nif_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nif_2 b.6.1.3 (167-340) Nitrite reductase, NIR {Achromobacter cycloclastes}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
SCOP Domain Coordinates for d1nif_2:
Click to download the PDB-style file with coordinates for d1nif_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nif_2:
- d1nif_2 first appeared (with stable ids) in SCOP 1.55
- d1nif_2 appears in SCOP 1.59
- d1nif_2 appears in the current release, SCOPe 2.08, called d1nifa2
View in 3D
