SCOPe 2.05: Domain d2a6pb_: 2a6p B:

Lineage for d2a6pb_ (2a6p B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.0: automated matches [196988] (1 protein)
   not a true family

6. Protein automated matches [196989] (8 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [230484] (1 PDB entry)

8. Domain d2a6pb_: 2a6p B: [230486]
   automated match to d1h2ea_
   complexed with gol, so4

Details for d2a6pb_

PDB Entry: 2a6p, 2.2 Å

PDB Description: Structure Solution to 2.2 Angstrom and Functional Characterisation of the Open Reading Frame Rv3214 from Mycobacterium tuberculosis

PDB Compounds: (B:) possible phosphoglycerate mutase gpm2

SCOPe Domain Sequences for d2a6pb_:

Sequence; same for both SEQRES and ATOM records:

>d2a6pb_ c.60.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rnhrllllrhgetawstlgrhtggteveltdtgrtqaelagqllgelelddpivicsprr
rtldtaklagltvnevtgllaewdygsyeglttpqiresepdwlvwthgcpagesvaqvn
dradsavalalehmssrdvlfvshghfsravitrwvqlplaegsrfamptasigicgfeh
gvrqlavlgltgh

Timeline for d2a6pb_:

• d2a6pb_ first appeared in SCOPe 2.03
  
• d2a6pb_ appears in SCOPe 2.04
  
• d2a6pb_ appears in SCOPe 2.06
  
• d2a6pb_ appears in the current release, SCOPe 2.08