SCOPe 2.03: Domain d1zxzb_: 1zxz B:

Lineage for d1zxzb_ (1zxz B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (9 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [230479] (4 PDB entries)

8. Domain d1zxzb_: 1zxz B: [230480]
   automated match to d3g5ka_
   complexed with zn

Details for d1zxzb_

PDB Entry: 1zxz, 2.8 Å

PDB Description: X-ray structure of peptide deformylase from Arabidopsis thaliana (AtPDF1A); crystals grown in PEG-5000 MME as precipitant

PDB Compounds: (B:) Peptide deformylase, mitochondrial

SCOPe Domain Sequences for d1zxzb_:

Sequence; same for both SEQRES and ATOM records:

>d1zxzb_ d.167.1.0 (B:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
dlpeivasgdpvlhekarevdpgeigseriqkiiddmikvmrlapgvglaapqigvplri
ivledtkeyisyapkeeilaqerrhfdlmvmvnpvlkersnkkalffegclsvdgfraav
erylevvvtgydrqgkrievnasgwqarilqhecdhldgnlyvdkmvprtfrtvdnldlp
laegcpklgsh

Timeline for d1zxzb_:

• d1zxzb_ is new in SCOPe 2.03-stable
  
• d1zxzb_ appears in SCOPe 2.04
  
• d1zxzb_ appears in the current release, SCOPe 2.08, called d1zxzb1