Lineage for d1nif_1 (1nif 8-166)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56191Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 56231Protein Nitrite reductase, NIR [49551] (3 species)
  7. 56232Species Achromobacter cycloclastes [TaxId:223] [49552] (7 PDB entries)
  8. 56233Domain d1nif_1: 1nif 8-166 [23048]

Details for d1nif_1

PDB Entry: 1nif (more details), 1.6 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted

SCOP Domain Sequences for d1nif_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nif_1 b.6.1.3 (8-166) Nitrite reductase, NIR {Achromobacter cycloclastes}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOP Domain Coordinates for d1nif_1:

Click to download the PDB-style file with coordinates for d1nif_1.
(The format of our PDB-style files is described here.)

Timeline for d1nif_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nif_2