Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225008] (3 PDB entries) |
Domain d1zxnd1: 1zxn D:29-265 [230477] Other proteins in same PDB: d1zxna2, d1zxnb2, d1zxnc2, d1zxnd2 automated match to d1zxmb1 complexed with adp, gol, mg, so4 |
PDB Entry: 1zxn (more details), 2.51 Å
SCOPe Domain Sequences for d1zxnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxnd1 d.122.1.0 (D:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]} sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk
Timeline for d1zxnd1: