Lineage for d1zxnc2 (1zxn C:266-426)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931010Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries)
  8. 2931038Domain d1zxnc2: 1zxn C:266-426 [230476]
    Other proteins in same PDB: d1zxna1, d1zxnb1, d1zxnc1, d1zxnd1
    automated match to d1zxmb2
    complexed with adp, gol, mg, so4

Details for d1zxnc2

PDB Entry: 1zxn (more details), 2.51 Å

PDB Description: Human DNA topoisomerase IIa ATPase/ADP
PDB Compounds: (C:) DNA topoisomerase II, alpha isozyme

SCOPe Domain Sequences for d1zxnc2:

Sequence, based on SEQRES records: (download)

>d1zxnc2 d.14.1.0 (C:266-426) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh
vdyvadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqp
ksfgstcqlsekfikaaigcgivesilnwvkfkaqvqlnkk

Sequence, based on observed residues (ATOM records): (download)

>d1zxnc2 d.14.1.0 (C:266-426) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdyvadqivtk
lvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqpksfgstcqlse
kfikaaigcgivesilnwvkfkaqvqlnkk

SCOPe Domain Coordinates for d1zxnc2:

Click to download the PDB-style file with coordinates for d1zxnc2.
(The format of our PDB-style files is described here.)

Timeline for d1zxnc2: