SCOPe 2.07: Domain d1zxnc1: 1zxn C:29-265

Lineage for d1zxnc1 (1zxn C:29-265)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225008] (14 PDB entries)

8. Domain d1zxnc1: 1zxn C:29-265 [230475]
   Other proteins in same PDB: d1zxna2, d1zxnb2, d1zxnc2, d1zxnd2
   automated match to d1zxmb1
   complexed with adp, gol, mg, so4

Details for d1zxnc1

PDB Entry: 1zxn, 2.51 Å

PDB Description: Human DNA topoisomerase IIa ATPase/ADP

PDB Compounds: (C:) DNA topoisomerase II, alpha isozyme

SCOPe Domain Sequences for d1zxnc1:

Sequence, based on SEQRES records:

>d1zxnc1 d.122.1.0 (C:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk

Sequence, based on observed residues (ATOM records):

>d1zxnc1 d.122.1.0 (C:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
snyddkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkpfng
edytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk

Timeline for d1zxnc1:

• d1zxnc1 first appeared in SCOPe 2.03
  
• d1zxnc1 appears in SCOPe 2.06
  
• d1zxnc1 appears in the current release, SCOPe 2.08