Lineage for d1zxnb1 (1zxn B:29-265)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667910Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1667911Protein automated matches [226867] (11 species)
    not a true protein
  7. 1667946Species Human (Homo sapiens) [TaxId:9606] [225008] (10 PDB entries)
  8. 1667962Domain d1zxnb1: 1zxn B:29-265 [230473]
    Other proteins in same PDB: d1zxna2, d1zxnb2, d1zxnc2, d1zxnd2
    automated match to d1zxmb1
    complexed with adp, gol, mg, so4

Details for d1zxnb1

PDB Entry: 1zxn (more details), 2.51 Å

PDB Description: Human DNA topoisomerase IIa ATPase/ADP
PDB Compounds: (B:) DNA topoisomerase II, alpha isozyme

SCOPe Domain Sequences for d1zxnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxnb1 d.122.1.0 (B:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk

SCOPe Domain Coordinates for d1zxnb1:

Click to download the PDB-style file with coordinates for d1zxnb1.
(The format of our PDB-style files is described here.)

Timeline for d1zxnb1: