![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (23 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries) |
![]() | Domain d1zxna2: 1zxn A:266-422 [230472] Other proteins in same PDB: d1zxna1, d1zxnb1, d1zxnc1, d1zxnd1 automated match to d1zxmb2 complexed with adp, gol, mg, so4 |
PDB Entry: 1zxn (more details), 2.51 Å
SCOPe Domain Sequences for d1zxna2:
Sequence, based on SEQRES records: (download)
>d1zxna2 d.14.1.0 (A:266-422) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh vdyvadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqp ksfgstcqlsekfikaaigcgivesilnwvkfkaqvq
>d1zxna2 d.14.1.0 (A:266-422) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfrsyvdmylkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdyvadqivtk lvhqvknhmwifvnalienptfdsqtkenmtlqpksfgstcqlsekfikaaigivesiln wvkfkaqvq
Timeline for d1zxna2: