Lineage for d1zxna1 (1zxn A:29-265)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213592Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2213593Protein automated matches [226867] (14 species)
    not a true protein
  7. 2213640Species Human (Homo sapiens) [TaxId:9606] [225008] (12 PDB entries)
  8. 2213660Domain d1zxna1: 1zxn A:29-265 [230471]
    Other proteins in same PDB: d1zxna2, d1zxnb2, d1zxnc2, d1zxnd2
    automated match to d1zxmb1
    complexed with adp, gol, mg, so4

Details for d1zxna1

PDB Entry: 1zxn (more details), 2.51 Å

PDB Description: Human DNA topoisomerase IIa ATPase/ADP
PDB Compounds: (A:) DNA topoisomerase II, alpha isozyme

SCOPe Domain Sequences for d1zxna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxna1 d.122.1.0 (A:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk

SCOPe Domain Coordinates for d1zxna1:

Click to download the PDB-style file with coordinates for d1zxna1.
(The format of our PDB-style files is described here.)

Timeline for d1zxna1: