Lineage for d1qnif1 (1qni F:451-581)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56339Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 56340Protein Nitrous oxide reductase, C-terminal domain [49548] (2 species)
  7. 56346Species Pseudomonas nautica [TaxId:2743] [49549] (1 PDB entry)
  8. 56352Domain d1qnif1: 1qni F:451-581 [23047]
    Other proteins in same PDB: d1qnia2, d1qnib2, d1qnic2, d1qnid2, d1qnie2, d1qnif2

Details for d1qnif1

PDB Entry: 1qni (more details), 2.4 Å

PDB Description: crystal structure of nitrous oxide reductase from pseudomonas nautica, at 2.4a resolution

SCOP Domain Sequences for d1qnif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnif1 b.6.1.4 (F:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica}
kiyerndpyfascraqaekdgvtlesdnkvirdgnkvrvymtsvapqygmtdfkvkegde
vtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtftagkpgvywyycnwfchalhm
emvgrmlveaa

SCOP Domain Coordinates for d1qnif1:

Click to download the PDB-style file with coordinates for d1qnif1.
(The format of our PDB-style files is described here.)

Timeline for d1qnif1: