Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) |
Family d.41.1.0: automated matches [230464] (1 protein) not a true family |
Protein automated matches [230465] (2 species) not a true protein |
Species Oligotropha carboxidovorans [TaxId:504832] [230466] (1 PDB entry) |
Domain d1zxie1: 1zxi E:15-146 [230467] Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib2, d1zxic1, d1zxic2, d1zxid1, d1zxid2, d1zxie2, d1zxif1, d1zxif2 automated match to d1n62b1 complexed with cu, cum, fad, fes, mcn, po4 |
PDB Entry: 1zxi (more details), 1.7 Å
SCOPe Domain Sequences for d1zxie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxie1 d.41.1.0 (E:15-146) automated matches {Oligotropha carboxidovorans [TaxId: 504832]} aeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidtskaka lpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryvaadaie lvevdyeplpvl
Timeline for d1zxie1: