Lineage for d1zxie1 (1zxi E:15-146)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902857Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1902858Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 1902943Family d.41.1.0: automated matches [230464] (1 protein)
    not a true family
  6. 1902944Protein automated matches [230465] (2 species)
    not a true protein
  7. 1902966Species Oligotropha carboxidovorans [TaxId:504832] [230466] (1 PDB entry)
  8. 1902968Domain d1zxie1: 1zxi E:15-146 [230467]
    Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib2, d1zxic1, d1zxic2, d1zxid1, d1zxid2, d1zxie2, d1zxif1, d1zxif2
    automated match to d1n62b1
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxie1

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (E:) Carbon monoxide dehydrogenase large chain

SCOPe Domain Sequences for d1zxie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxie1 d.41.1.0 (E:15-146) automated matches {Oligotropha carboxidovorans [TaxId: 504832]}
aeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidtskaka
lpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryvaadaie
lvevdyeplpvl

SCOPe Domain Coordinates for d1zxie1:

Click to download the PDB-style file with coordinates for d1zxie1.
(The format of our PDB-style files is described here.)

Timeline for d1zxie1: