![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [254758] (5 PDB entries) |
![]() | Domain d1zoyb1: 1zoy B:9-114 [230460] Other proteins in same PDB: d1zoya1, d1zoya2, d1zoya3, d1zoyb2, d1zoyc_, d1zoyd_ automated match to d2bs2b2 complexed with eph, f3s, fad, fes, hem, sf4, uq1 |
PDB Entry: 1zoy (more details), 2.4 Å
SCOPe Domain Sequences for d1zoyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zoyb1 d.15.4.2 (B:9-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg icgscamninggntlactrridtnldkvskiyplphmyvikdlvpd
Timeline for d1zoyb1: