Lineage for d1qnie1 (1qni E:451-581)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11128Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 11148Protein Nitrous oxide reductase, C-terminal domain [49548] (1 species)
  7. 11149Species Pseudomonas nautica [TaxId:2743] [49549] (1 PDB entry)
  8. 11154Domain d1qnie1: 1qni E:451-581 [23046]
    Other proteins in same PDB: d1qnia2, d1qnib2, d1qnic2, d1qnid2, d1qnie2, d1qnif2

Details for d1qnie1

PDB Entry: 1qni (more details), 2.4 Å

PDB Description: crystal structure of nitrous oxide reductase from pseudomonas nautica, at 2.4a resolution

SCOP Domain Sequences for d1qnie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnie1 b.6.1.2 (E:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica}
kiyerndpyfascraqaekdgvtlesdnkvirdgnkvrvymtsvapqygmtdfkvkegde
vtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtftagkpgvywyycnwfchalhm
emvgrmlveaa

SCOP Domain Coordinates for d1qnie1:

Click to download the PDB-style file with coordinates for d1qnie1.
(The format of our PDB-style files is described here.)

Timeline for d1qnie1: