Lineage for d1qnie1 (1qni E:451-581)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367899Family b.6.1.4: Nitrosocyanin [63392] (2 protein domains)
  6. 2367900Protein Nitrous oxide reductase, C-terminal domain [49548] (2 species)
  7. 2367906Species Pseudomonas nautica [TaxId:2743] [49549] (1 PDB entry)
  8. 2367911Domain d1qnie1: 1qni E:451-581 [23046]
    Other proteins in same PDB: d1qnia2, d1qnib2, d1qnic2, d1qnid2, d1qnie2, d1qnif2
    complexed with ca, cl, cua, cuz

Details for d1qnie1

PDB Entry: 1qni (more details), 2.4 Å

PDB Description: crystal structure of nitrous oxide reductase from pseudomonas nautica, at 2.4a resolution
PDB Compounds: (E:) nitrous-oxide reductase

SCOPe Domain Sequences for d1qnie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnie1 b.6.1.4 (E:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]}
kiyerndpyfascraqaekdgvtlesdnkvirdgnkvrvymtsvapqygmtdfkvkegde
vtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtftagkpgvywyycnwfchalhm
emvgrmlveaa

SCOPe Domain Coordinates for d1qnie1:

Click to download the PDB-style file with coordinates for d1qnie1.
(The format of our PDB-style files is described here.)

Timeline for d1qnie1: