Lineage for d1zlwk2 (1zlw K:108-212)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517817Domain d1zlwk2: 1zlw K:108-212 [230458]
    Other proteins in same PDB: d1zlwh1, d1zlwh2, d1zlwk1, d1zlwl1, d1zlwm1, d1zlwm2
    automated match to d1n0xl2
    complexed with man

Details for d1zlwk2

PDB Entry: 1zlw (more details), 2.85 Å

PDB Description: fab 2g12 + man8
PDB Compounds: (K:) FAB 2G12, light chain

SCOPe Domain Sequences for d1zlwk2:

Sequence, based on SEQRES records: (download)

>d1zlwk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Sequence, based on observed residues (ATOM records): (download)

>d1zlwk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1zlwk2:

Click to download the PDB-style file with coordinates for d1zlwk2.
(The format of our PDB-style files is described here.)

Timeline for d1zlwk2: