Lineage for d1zlwk1 (1zlw K:2-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520118Domain d1zlwk1: 1zlw K:2-107 [230455]
    Other proteins in same PDB: d1zlwh1, d1zlwh2, d1zlwk2, d1zlwl2, d1zlwm1, d1zlwm2
    automated match to d1n0xl1
    complexed with man

Details for d1zlwk1

PDB Entry: 1zlw (more details), 2.85 Å

PDB Description: fab 2g12 + man8
PDB Compounds: (K:) FAB 2G12, light chain

SCOPe Domain Sequences for d1zlwk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlwk1 b.1.1.0 (K:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveik

SCOPe Domain Coordinates for d1zlwk1:

Click to download the PDB-style file with coordinates for d1zlwk1.
(The format of our PDB-style files is described here.)

Timeline for d1zlwk1: