| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (9 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
| Domain d1zluk2: 1zlu K:108-212 [230452] Other proteins in same PDB: d1zluh1, d1zluh2, d1zluk1, d1zlul1, d1zlum1, d1zlum2 automated match to d1n0xl2 |
PDB Entry: 1zlu (more details), 2.75 Å
SCOPe Domain Sequences for d1zluk2:
Sequence, based on SEQRES records: (download)
>d1zluk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
>d1zluk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskyekhkvyacevthqglsspvtksfnrg
Timeline for d1zluk2: