Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries) |
Domain d1zluk1: 1zlu K:2-107 [230451] Other proteins in same PDB: d1zluh1, d1zluh2, d1zluk2, d1zlul2, d1zlum1, d1zlum2 automated match to d1n0xl1 |
PDB Entry: 1zlu (more details), 2.75 Å
SCOPe Domain Sequences for d1zluk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zluk1 b.1.1.0 (K:2-107) automated matches {Homo sapiens [TaxId: 9606]} vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveik
Timeline for d1zluk1: