Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
Domain d1zlvk1: 1zlv K:2-107 [230449] Other proteins in same PDB: d1zlvh1, d1zlvh2, d1zlvk2, d1zlvl2, d1zlvm1, d1zlvm2 automated match to d1n0xl1 complexed with man |
PDB Entry: 1zlv (more details), 2.33 Å
SCOPe Domain Sequences for d1zlvk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zlvk1 b.1.1.0 (K:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveik
Timeline for d1zlvk1: