Lineage for d1zlsl2 (1zls L:108-210)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294295Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
  8. 1294515Domain d1zlsl2: 1zls L:108-210 [230446]
    Other proteins in same PDB: d1zlsh1, d1zlsh2, d1zlsl1
    automated match to d1n0xl2

Details for d1zlsl2

PDB Entry: 1zls (more details), 2 Å

PDB Description: fab 2g12 + man4
PDB Compounds: (L:) FAB 2G12, light chain

SCOPe Domain Sequences for d1zlsl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlsl2 b.1.1.2 (L:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfn

SCOPe Domain Coordinates for d1zlsl2:

Click to download the PDB-style file with coordinates for d1zlsl2.
(The format of our PDB-style files is described here.)

Timeline for d1zlsl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zlsl1