SCOPe 2.08: Domain d1zkla_: 1zkl A:

Lineage for d1zkla_ (1zkl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d1zkla_: 1zkl A: [230444]
   automated match to d3ecma_
   complexed with ibm, mg, zn

Details for d1zkla_

PDB Entry: 1zkl, 1.67 Å

PDB Description: Multiple Determinants for Inhibitor Selectivity of Cyclic Nucleotide Phosphodiesterases

PDB Compounds: (A:) High-affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A

SCOPe Domain Sequences for d1zkla_:

Sequence; same for both SEQRES and ATOM records:

>d1zkla_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyngqakcmlekvgnwnfdiflfdrltngnslvsltfhlfslhglieyfhldmmklrrfl
vmiqedyhsqnpyhnavhaadvtqamhcylkepklansvtpwdillsliaaathdldhpg
vnqpfliktnhylatlykntsvlenhhwrsavgllresglfshlplesrqqmetqigali
latdisrqneylslfrshldrgdlcledtrhrhlvlqmalkcadicnpcrtwelskqwse
kvteeffhqgdiekkyhlgvsplcdrhtesianiqigfmtylveplftewarfsntrlsq
tmlghvglnkaswkglq

Timeline for d1zkla_:

• d1zkla_ first appeared in SCOPe 2.03
  
• d1zkla_ appears in SCOPe 2.07