Lineage for d1zi0a_ (1zi0 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065762Superfamily b.68.10: GyrA/ParC C-terminal domain-like [101904] (2 families) (S)
    beta-pinwheel, a variant of beta-propeller fold; unlike an canonical beta-propeller, strands 1 and 4 of each four-strand repeat unit are in one blade whereas strands 2 and 3 are in the next blade
  5. 2065770Family b.68.10.0: automated matches [227275] (1 protein)
    not a true family
  6. 2065771Protein automated matches [227082] (2 species)
    not a true protein
  7. 2065772Species Escherichia coli [TaxId:562] [230441] (1 PDB entry)
  8. 2065773Domain d1zi0a_: 1zi0 A: [230442]
    automated match to d4g3na_

Details for d1zi0a_

PDB Entry: 1zi0 (more details), 2.6 Å

PDB Description: A Superhelical Spiral in Escherichia coli DNA Gyrase A C-terminal Domain Imparts Unidirectional Supercoiling Bias
PDB Compounds: (A:) DNA gyrase subunit A

SCOPe Domain Sequences for d1zi0a_:

Sequence, based on SEQRES records: (download)

>d1zi0a_ b.68.10.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tqedvvvtlshqgyvkyqplseyeaqrrggkgksaarikeedfidrllvanthdhilcfs
srgrvysmkvyqlpeatrgargrpivnllpleqderitailpvtefeegvkvfmatangt
vkktvltefnrlrtagkvaiklvdgdeligvdltsgedevmlfsaegkvvrfkessvram
gcnttgvrgirlgegdkvvslivprgdgailtatqngygkrtavaeyptksratkgvisi
kvternglvvgavqvddcdqimmitdagtlvrtrvseisivgrntqgvilirtaedenvv
glqrvae

Sequence, based on observed residues (ATOM records): (download)

>d1zi0a_ b.68.10.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tqedvvvtlshqgyvkyqplsdfidrllvanthdhilcfssrgrvysmkvyqlpeatrga
rgrpivnllpleqderitailpvtefeegvkvfmatangtvkktvltefnrlrtagkvai
klvdgdeligvdltsgedevmlfsaegkvvrfkessvramgcnttgvrgirlgegdkvvs
livprgdgailtatqngygkrtavaeyptksratkgvisikvternglvvgavqvddcdq
immitdagtlvrtrvseisivgrntqgvilirtaedenvvglqrvae

SCOPe Domain Coordinates for d1zi0a_:

Click to download the PDB-style file with coordinates for d1zi0a_.
(The format of our PDB-style files is described here.)

Timeline for d1zi0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zi0b_